Iright
BRAND / VENDOR: Proteintech

Proteintech, 86604-3-RR, Glycerokinase Recombinant monoclonal antibody

CATALOG NUMBER: 86604-3-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The Glycerokinase (86604-3-RR) by Proteintech is a Recombinant antibody targeting Glycerokinase in WB, ELISA applications with reactivity to human, mouse, rat samples 86604-3-RR targets Glycerokinase in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, rat kidney tissue, mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Glycerokinase, also known as glycerol kinase (GK, EC 2.7.1.30), is a widely conserved phosphotransferase that catalyzes the ATP-dependent phosphorylation of glycerol to generate sn-glycerol-3-phosphate (G3P). Glycerokinase exists as four isoforms with apparent molecular masses of 61 kDa, 57 kDa, 61 kDa, and 58 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4175 Product name: Recombinant human GK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-357 aa of BC037549 Sequence: MAASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKITGEPLYNAVVWLDLRTQSTVESLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEKRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKQLCEFFGIPMEILPNVRSSSEIYGLMKAGALEGVPISGCLGDQSAALVGQMCFQIGQAKNTYGTGCFLLCNTGHKCVFSDHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYG Predict reactive species Full Name: glycerol kinase Calculated Molecular Weight: 524 aa, 57 kDa Observed Molecular Weight: 50-60 kDa GenBank Accession Number: BC037549 Gene Symbol: Glycerokinase Gene ID (NCBI): 2710 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P32189 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924