Iright
BRAND / VENDOR: Proteintech

Proteintech, 86609-3-RR, GFPT2 Recombinant monoclonal antibody

CATALOG NUMBER: 86609-3-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The GFPT2 (86609-3-RR) by Proteintech is a Recombinant antibody targeting GFPT2 in WB, ELISA applications with reactivity to human, mouse samples 86609-3-RR targets GFPT2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells, A375 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information GFPT2 (Glutamine-fructose-6phosphate transaminase 2) is a rate-limiting enzyme in hexosamine biosynthesis involved in the occurrence and progress of many cancers (PMID: 35330716, 14764791). GFPT2 plays an important role in the metabolic activity of cells, especially in their glucose metabolism. GFPT2 expression was highly correlated with EMT-related factors (PMID: 37395335). High GFPT2 expression is associated with poor prognosis in various tumors, including lung adenocarcinoma, colorectal cancer, leiomyosarcoma, and serous ovarian cancer. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7275 Product name: Recombinant human GFPT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 330-682 aa of BC000012 Sequence: IFEQPESVFNTMRGRVNFETNTVLLGGLKDHLKEIRRCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFISQSGETADTLLALRYCKDRGALTVGVTNTVGSSISRETDCGVHINAGPEVGVASTKAYTSQFISLVMFGLMMSEDRISLQNRRQEIIRGLRSLPELIKEVLSLEEKIHDLALELYTQRSLLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALIDKQMPVIMVIMKDPCFAKCQNALQQVTARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFHLAVLRGYDVDFPRNLAKSVTVE Predict reactive species Full Name: glutamine-fructose-6-phosphate transaminase 2 Calculated Molecular Weight: 77 kDa Observed Molecular Weight: 75-77 kDa GenBank Accession Number: BC000012 Gene Symbol: GFPT2 Gene ID (NCBI): 9945 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O94808 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924