Iright
BRAND / VENDOR: Proteintech

Proteintech, 86613-3-RR, ATXN2L Recombinant monoclonal antibody

CATALOG NUMBER: 86613-3-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The ATXN2L (86613-3-RR) by Proteintech is a Recombinant antibody targeting ATXN2L in WB, IF/ICC, ELISA applications with reactivity to human samples 86613-3-RR targets ATXN2L in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, MKN-45 cells, HEK-293T cells, A549 cells, Jurkat cells Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information ATXN2L is a paralog of Ataxin-2 (ATXN2) but without abnormal polyQ expended track, which is conserved in most of the ATXNs and drives the pathogenesis of neurodegeneration. It was reported that ATXN2L was widely expressed in immortalized cell lines, and ATXN2L-JAK2 fusion was found in CD4-positive T-cell lymphoma. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag20581 Product name: Recombinant human ATXN2L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 712-1062 aa of BC082760 Sequence: SYIPQIHMGPAVQAPQMYPYPVSNSVPGQQGKYRGAKGSLPPQRSDQHQPASAPPMMQAAAAAGPPLVAATPYSSYIPYNPQQFPGQPAMMQPMAHYPSQPVFAPMLQSNPRMLTSGSHPQAIVSSSTPQYPSAEQPTPQALYATVHQSYPHHATQLHAHQPQPATTPTGSQPQSQHAAPSPVQHQAGQAPHLGSGQPQQNLYHPGALTGTPPSLPPGPSAQSPQSSFPQPAAVYAIHHQQLPHGFTNMAHVTQAHVQTGITAAPPPHPGAPHPPQVMLLHPPQSHGGPPQGAVPQSGVPALSASTPSPYPYIGHPQGEQPGQAPGFPGGADDRILQSHPSQQLPFHPPGN Predict reactive species Full Name: ataxin 2-like Calculated Molecular Weight: 1062 aa, 112 kDa Observed Molecular Weight: 150 kDa GenBank Accession Number: BC082760 Gene Symbol: ATXN2L Gene ID (NCBI): 11273 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8WWM7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924