Iright
BRAND / VENDOR: Proteintech

Proteintech, 86647-1-RR, EAAT4 Recombinant monoclonal antibody

CATALOG NUMBER: 86647-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The EAAT4 (86647-1-RR) by Proteintech is a Recombinant antibody targeting EAAT4 in WB, ELISA applications with reactivity to human, mouse, rat samples 86647-1-RR targets EAAT4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: U-87 MG cells, A375 cells, PC-3 cells, U-251 cells, NIH/3T3 cells, RAW 264.7, PC-12 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Excitatory amino acid transporter 4 (EAAT4) is a neuronal glutamate transporter responsible for the reuptake of synaptically released glutamate. The EAAT4 protein is highly enriched in Purkinje cells of the cerebellum, although it is not restricted to these cells (18770868). While the predicted molecular weight of EAAT4 is 62 kDa, considerable heterogeneity in transporter size has been reported in the brain with molecular weights ranging from 50 to 120 kDa as a result of differential glycosylation and/or phosphorylation (24056007). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3554 Product name: Recombinant human SLC1A6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 149-271 aa of BC028721 Sequence: MVTIIHPGKGSKEGLHREGRIETIPTADAFMDLIRNMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENVTRALGTLQEMLSFEETVPVPGSANGINALGL Predict reactive species Full Name: solute carrier family 1 (high affinity aspartate/glutamate transporter), member 6 Calculated Molecular Weight: 61.6 kDa Observed Molecular Weight: 62 kDa GenBank Accession Number: BC028721 Gene Symbol: EAAT4 Gene ID (NCBI): 6511 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P48664 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924