Iright
BRAND / VENDOR: Proteintech

Proteintech, 86651-1-RR, Nucleoside phosphorylase Recombinant monoclonal antibody

CATALOG NUMBER: 86651-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The Nucleoside phosphorylase (86651-1-RR) by Proteintech is a Recombinant antibody targeting Nucleoside phosphorylase in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 86651-1-RR targets Nucleoside phosphorylase in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, K-562 cells, U-937 cells, HL-60 cells, Raji cells, NIH/3T3 cells, rat spleen tissue Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Purine nucleoside phosphorylases (PNP) is a ubiquitous enzyme of purine metabolism that functions in the salvage pathway, including even those of protozoan parasites, thus enabling the cells to utilize purine bases recovered from metabolized purine ribo- and deoxyribonucleosides to synthesize purine nucleotides (PMID: 11337031, 23332162). PNP deficiency in humans leads to an impairment of T-cell function, usually with no apparent effects on B-cell function. hPNP is widely distributed in various tissues and cells of the human body, with the highest activity in kidney, peripheral lymphocytes and granulocytes (PMID: 38701712). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag12507 Product name: Recombinant human NP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-289 aa of BC106074 Sequence: MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS Predict reactive species Full Name: nucleoside phosphorylase Calculated Molecular Weight: 289 aa, 32 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC106074 Gene Symbol: Purine nucleoside phosphorylase Gene ID (NCBI): 4860 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P00491 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924