Iright
BRAND / VENDOR: Proteintech

Proteintech, 86681-2-RR, MBD3 Recombinant monoclonal antibody

CATALOG NUMBER: 86681-2-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The MBD3 (86681-2-RR) by Proteintech is a Recombinant antibody targeting MBD3 in WB, IF/ICC, ELISA applications with reactivity to human samples 86681-2-RR targets MBD3 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, COLO 320 cells, Y79 cells, Jurkat cells, MCF-7 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Methyl-CpG-binding domain 3 (Mbd3), a member among the five-MBD protein family, is unique in its ability to specifically recognize 5′-hydroxymethyl-cytosine (5′-hmC), an epigenetic marker that is highly enriched in stem cells and cancer. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5531 Product name: Recombinant human MBD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-259 aa of BC043619 Sequence: MERKSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIAEELVKTMDLPKGLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLEEALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEEEEPDPDPEMEHV Predict reactive species Full Name: methyl-CpG binding domain protein 3 Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC043619 Gene Symbol: MBD3 Gene ID (NCBI): 53615 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O95983 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924