Proteintech, 86690-1-RR, CROP Recombinant monoclonal antibody

Size: 20ul / 100ul The CROP (86690-1-RR) by Proteintech is a Recombinant antibody targeting CROP in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 86690-1-RR targets CROP in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, RT-4 cells, HepG2 cells, mouse brain tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information CROP, a putative SR protein, contain cystine/histidine motifs and leucine zipper-like repeats in the N-terminal half and consists mostly of charged and polar amino acids in the C-terminal half. CROP has a high expression in heart, brain, pancreas, thymus, and weak in lung, live and kidney. As the human homologue of yeast Luc7p, CROP is supported to be participated in 5'-splice site recognize and is essential for vegetative growth. This is a rabbit polyclonal antibody raised against part of N-terminus of CROP of human origin, and can recognize a ~58kDa band of CROP. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5961 Product name: Recombinant human CROP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-79 aa of BC056409 Sequence: MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLDVFGRGDNISDVSKFLEDDKWMEE Predict reactive species Full Name: cisplatin resistance-associated overexpressed protein Calculated Molecular Weight: 51 kDa Observed Molecular Weight: 55-58 kDa GenBank Accession Number: BC056409 Gene Symbol: CROP Gene ID (NCBI): 51747 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O95232 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.