Proteintech, 86696-1-RR, KCNIP2 Recombinant monoclonal antibody

Size: 20ul / 100ul The KCNIP2 (86696-1-RR) by Proteintech is a Recombinant antibody targeting KCNIP2 in WB, ELISA applications with reactivity to human, mouse, rat samples 86696-1-RR targets KCNIP2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information KCNIP2 is a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14111 Product name: Recombinant human KCNIP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC034685 Sequence: MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSENSVDDEFELSTVCH Predict reactive species Full Name: Kv channel interacting protein 2 Calculated Molecular Weight: 270 aa, 31 kDa Observed Molecular Weight: 31-35 kDa GenBank Accession Number: BC034685 Gene Symbol: KCNIP2 Gene ID (NCBI): 30819 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NS61 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.