Iright
BRAND / VENDOR: Proteintech

Proteintech, 86698-1-RR, CXCL7/PPBP Recombinant monoclonal antibody

CATALOG NUMBER: 86698-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CXCL7/PPBP (86698-1-RR) by Proteintech is a Recombinant antibody targeting CXCL7/PPBP in WB, IF/ICC, ELISA applications with reactivity to human samples 86698-1-RR targets CXCL7/PPBP in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human peripheral blood platelets Positive IF/ICC detected in: Transfected CHO-K1 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PPBP, also named as CXCL7, NAP2, or β-Thromboglobulin, is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent chemoattractant and activator of neutrophils. It has been shown to stimulate various cellular processes including DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by synovial cells. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3690 Product name: Recombinant Human CXCL7/PBP protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 59-128 aa of NM_002704.3 Sequence: AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD Predict reactive species Full Name: pro-platelet basic protein (chemokine (C-X-C motif) ligand 7) Calculated Molecular Weight: 14kDa Observed Molecular Weight: 8-14 kDa GenBank Accession Number: NM_002704.3 Gene Symbol: PPBP Gene ID (NCBI): 5473 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P02775 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924