Proteintech, 86703-1-RR, DNAJC6 Recombinant monoclonal antibody

Size: 20ul / 100ul The DNAJC6 (86703-1-RR) by Proteintech is a Recombinant antibody targeting DNAJC6 in WB, ELISA applications with reactivity to human, mouse, rat samples 86703-1-RR targets DNAJC6 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue, mouse cerebellum tissue, rat cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information DNAJC6, also named AUXILIN, belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. It is a neuronal protein that functions specifically in the pathway of clathrin-mediated endocytosis. It shares homology with GAK, and the two proteins act as cochaperones to support the HSC70 -dependent clathrin uncoating of clathrin-coated vesicles (PMID: 2016009). DNAJC6 is expressed in various brain regions, including cerebellum, corpus callosum, cortex, striatum, brainstem, pons, putamen, spinal cord and substantia nigra (PMID: 23211418). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag16612 Product name: Recombinant human DNAJC6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 387-733 aa of BC109279 Sequence: IPLDTTVLKFTKPELDACDVPEKYPQLFQVTLDVELQPHDKVIDLTPPWEHYCTKDVNPSILFSSHQEHQDTLALGGQAPIDIPPDNPRHYGQSGFFASLCWQDQKSEKSFCEEDHAALVNQESEQSDDELLTLSSPHGNANGDKPHGVKKPSKKQQEPAAPPPPEDVDLLGLEGSAMSNSFSPPAAPPTNSELLSDLFGGGGAAGPTQAGQSGVEDVFHPSGPASTQSTPRRSATSTSASPTLRVGEGATFDPFGAPSKPSGQDLLGSFLNTSSASSDPFLQPTRSPSPTVHASSTPAVNIQPDVSGGWDWHAKPGGFGMGSKSAATSPTGSSHGTPTHQSKPQTL Predict reactive species Full Name: DnaJ (Hsp40) homolog, subfamily C, member 6 Calculated Molecular Weight: 970 aa, 106 kDa Observed Molecular Weight: 100-110 kDa GenBank Accession Number: BC109279 Gene Symbol: DNAJC6/AUXILIN Gene ID (NCBI): 9829 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O75061 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.