Iright
BRAND / VENDOR: Proteintech

Proteintech, 86708-1-RR, GSTP1 Recombinant monoclonal antibody

CATALOG NUMBER: 86708-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The GSTP1 (86708-1-RR) by Proteintech is a Recombinant antibody targeting GSTP1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 86708-1-RR targets GSTP1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, COLO 320 cells, K-562 cells, HEK-293 cells, mouse brain tissue, rat brain tissue Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information Glutathione S-transferase Pi (GSTP1) is anisozyme encoded by the GST pi gene that plays an importantregulatory role in detoxification, anti‑oxidative damage, and the occurrence of various diseases (PMID: 14755684). GSTP1 conjugates reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. It is involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2) (PMID:9084911). GSTP1 methylation is frequently associated with tumor development or poor prognosis in a wide range of tumors such as neuroblastoma, hepatocellular carcinoma, endometrial, breast, and prostate cancers (PCa) (PMID: 27594734). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag8731 Product name: Recombinant human GSTP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-210 aa of BC010915 Sequence: MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ Predict reactive species Full Name: glutathione S-transferase pi 1 Calculated Molecular Weight: 210 aa, 23 kDa Observed Molecular Weight: 23~28 kDa GenBank Accession Number: BC010915 Gene Symbol: GSTP1 Gene ID (NCBI): 2950 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P09211 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924