Product Description
Size: 20ul / 100ul
The LIX1L (86712-3-RR) by Proteintech is a Recombinant antibody targeting LIX1L in WB, IP, ELISA applications with reactivity to human samples
86712-3-RR targets LIX1L in WB, IP, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: Jurkat cells, HeLa cells, SH-SY5Y cells, K-562 cells, HL-60 cells
Positive IP detected in: Jurkat cells
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Background Information
Limb expression 1-like protein (LIX1L) is a putative RNA binding protein that contains a double-stranded RNA-binding motif. LIX1L is highly expressed in various cancer tissues.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag22209 Product name: Recombinant human LIX1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC035727 Sequence: METMRAQRLQPGVGTSGRGTLRALRPGVTGAAAATATPPAGPPPAPPPPAPPPPPLLLSGAPGLPLPPGAAGSPAVLREAVEAVVRSFAKHTQGYGRVNVVE Predict reactive species
Full Name: Lix1 homolog (mouse)-like
Calculated Molecular Weight: 337 aa, 37 kDa
Observed Molecular Weight: 35-40 kDa
GenBank Accession Number: BC035727
Gene Symbol: LIX1L
Gene ID (NCBI): 128077
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: Q8IVB5
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924