Proteintech, 86721-1-RR, GRP75 Recombinant monoclonal antibody

Size: 20ul / 100ul The GRP75 (86721-1-RR) by Proteintech is a Recombinant antibody targeting GRP75 in WB, ELISA applications with reactivity to human, mouse samples 86721-1-RR targets GRP75 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, SW480 cells, A549 cells, HT-29 cells, NIH/3T3 cells, mouse liver tissue, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information GRP75 (also known as mortalin, HSPA9 or mt-Hsp70) is a constitutively expressed member of the HSPA (HSP70) family of heat-shock proteins. It is located in the mitochondrial matrix and anti-GRP75 is commonly used as the marker for mitochondria. It has been reported that GRP75 is enriched in cancer cells and contributes to carcinogenesis. In addition, decreased expression level of GRP75 has been found in neurodegenerative disorders like Parkinson's disease. (PMID: 21640711, 22920904) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag6673 Product name: Recombinant human GRP75 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 331-679 aa of BC000478 Sequence: YLTMDSSGPKHLNMKLTRAQFEGIVTDLIRRTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ Predict reactive species Full Name: heat shock 70kDa protein 9 (mortalin) Calculated Molecular Weight: 74 kDa Observed Molecular Weight: 70-75 kDa GenBank Accession Number: BC000478 Gene Symbol: GRP75 Gene ID (NCBI): 3313 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P38646 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.