Iright
BRAND / VENDOR: Proteintech

Proteintech, 86733-3-RR, NCF1/p47 phox Recombinant monoclonal antibody

CATALOG NUMBER: 86733-3-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The NCF1/p47 phox (86733-3-RR) by Proteintech is a Recombinant antibody targeting NCF1/p47 phox in WB, ELISA applications with reactivity to human, mouse samples 86733-3-RR targets NCF1/p47 phox in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Ramos cells, Daudi cells, Raji cells, RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag28089 Product name: Recombinant human NCF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 31-190 aa of BC002816 Sequence: KWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENRIIPHLPAPKWFDGQRAAENRQGTLTEYCSTLMSLPTKISRCPHLLDFFKVRPDDLKLPTDNQTKKPETYLMPKDGKSTATDITGPIILQTYRAIANYEKTSGSEMALSTGDVVEVVEKSE Predict reactive species Full Name: neutrophil cytosolic factor 1 Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC002816 Gene Symbol: p47phox/NCF1 Gene ID (NCBI): 653361 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P14598 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924