Iright
BRAND / VENDOR: Proteintech

Proteintech, 86787-1-RR, RAB10 Recombinant monoclonal antibody

CATALOG NUMBER: 86787-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The RAB10 (86787-1-RR) by Proteintech is a Recombinant antibody targeting RAB10 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 86787-1-RR targets RAB10 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, HUVEC cells, C2C12 cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information RAB10 is a member of the RAB family of small GTPases, which are key regulators of vesicular trafficking. RAB proteins are cyclically controlled, requiring a GDP-GTP exchange that is facilitated by RAB guanine nucleotide exchange factors. Rab10 plays essential functional roles in development: mice are embryonic lethal when both alleles are deleted. In addition, RAB10 plays a role in maintenance and regulation of endoplasmic reticulum (ER) morphology. RAB10 function has also been linked to neuronal morphology and polarization, playing a critical role in axonal development and dendrite arborization. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25830 Product name: Recombinant human RAB10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 130-200 aa of BC000896 Sequence: RVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC Predict reactive species Full Name: RAB10, member RAS oncogene family Calculated Molecular Weight: 200 aa, 23 kDa Observed Molecular Weight: 20-23 kDa GenBank Accession Number: BC000896 Gene Symbol: RAB10 Gene ID (NCBI): 10890 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P61026 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924