Proteintech, 86803-1-RR, MPZL3 Recombinant monoclonal antibody

Size: 20ul / 100ul The MPZL3 (86803-1-RR) by Proteintech is a Recombinant antibody targeting MPZL3 in WB, ELISA applications with reactivity to mouse, rat samples 86803-1-RR targets MPZL3 in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information MPZL3(Myelin Protein Zero Like 3) is a transmembrane protein belonging to the myelin protein zero (MPZ) gene family. It acts upstream of or within extracellular matrix organization and hair cycle. Predicted to be located in membrane. Predicted to be active in plasma membrane. Human ortholog(s) of this gene implicated in lung cancer. Orthologous to human MPZL3 (myelin protein zero like 3). Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg6821 Product name: Recombinant mouse MPZL3 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 33-158 aa of NM_001093749.2 Sequence: LEISADAHVRGYVGEKIKLKCTFKSSSDVTDKLTIDWTYRPPSSSRTESIFHYQSFQYPTTAGTFRDRISWAGNVYKGDASISISNPTLKDNGTFSCAVKNPPDVYHNIPLTELTVTERGFGTMLSS Predict reactive species Full Name: myelin protein zero-like 3 Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 70 kDa, 28 kDa GenBank Accession Number: NM_001093749.2 Gene Symbol: Mpzl3 Gene ID (NCBI): 319742 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q3V3F6-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.