Proteintech, 86820-1-RR, ENSA Recombinant monoclonal antibody

Size: 20ul / 100ul The ENSA (86820-1-RR) by Proteintech is a Recombinant antibody targeting ENSA in WB, IF/ICC, ELISA applications with reactivity to human samples 86820-1-RR targets ENSA in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SK-BR-3 cells, U2OS cells Positive IF/ICC detected in: COLO 320 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14484 Product name: Recombinant human ENSA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-121 aa of BC004461 Sequence: MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE Predict reactive species Full Name: endosulfine alpha Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 15-19 kDa GenBank Accession Number: BC004461 Gene Symbol: ENSA Gene ID (NCBI): 2029 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O43768 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.