Proteintech, 86832-2-RR, SH3PXD2A Recombinant monoclonal antibody

Size: 20ul / 100ul The SH3PXD2A (86832-2-RR) by Proteintech is a Recombinant antibody targeting SH3PXD2A in WB, ELISA applications with reactivity to human, mouse, rat samples 86832-2-RR targets SH3PXD2A in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, NIH/3T3 cells, HSC-T6 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information SH3PXD2A is also named as FISH, KIAA0418, SH3MD1, TKS5. SH3PXD2A contains an amino-terminal PX domain followed by five SH3 domains. It is a cytoplasmic protein in normal fibroblasts (PMID: 19464300). The p140 and p130 forms of SH3PXD2A may be generated by other splice variations. The complexity of SH3PXD2A isoforms is also evident in different cell types. For example in human platelets a single band of 150 kDa was detected, whereas all three forms were found in human fibroblasts and vascular smooth muscle cells (PMID: 9687503). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag39231 Product name: Recombinant human SH3PXD2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 834-1133 aa of NM_001394015.1 Sequence: TKKEWEGPATSYMTCSAYQKVQDSEISFPAGVEVQVLEKQESGWWYVRFGELEGWAPSHYLVLDENEQPDPSGKELDTVPAKGRQNEGKSDSLEKIERRVQALNTVNQSKKATPPIPSKPPGGFGKTSGTPAVKMRNGVRQVAVRPQSVFVSPPPKDNNLSCALRRNESLTATDGLRGVRRNSSFSTARSAAAEAKGRLAERAASQGSDSPLLPAQRNSIPVSPVRPKPIEKSQFIHNNLKDVYVSIADYEGDEETAGFQEGVSMEVLERNPNGWWYCQILDGVKPFKGWVPSNYLEKKN Predict reactive species Full Name: SH3 and PX domains 2A Calculated Molecular Weight: 125kDa，1133aa Observed Molecular Weight: 130-150 kDa GenBank Accession Number: NM_001394015.1 Gene Symbol: SH3PXD2A Gene ID (NCBI): 9644 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q5TCZ1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.