Proteintech, 86837-1-RR, TMEM97 Recombinant monoclonal antibody

Size: 20ul / 100ul The TMEM97 (86837-1-RR) by Proteintech is a Recombinant antibody targeting TMEM97 in WB, ELISA applications with reactivity to human, mouse samples 86837-1-RR targets TMEM97 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293T cells, MCF-7 cells, BT-549 cells, Caco-2 cells, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34803 Product name: Recombinant human TMEM97 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-69 aa of BC045655 Sequence: MTTLIPILSTFLFEDFSKASGFKGQRPETLHERLTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK Predict reactive species Full Name: transmembrane protein 97 Observed Molecular Weight: 19-20 kDa GenBank Accession Number: BC045655 Gene Symbol: TMEM97 Gene ID (NCBI): 27346 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q5BJF2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.