Product Description
Size: 20ul / 100ul
The ECHDC2 (86876-1-RR) by Proteintech is a Recombinant antibody targeting ECHDC2 in WB, ELISA applications with reactivity to human, mouse, rat samples
86876-1-RR targets ECHDC2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse liver tissue, rat liver tissue, mouse heart tissue, rat heart tissue, human heart tissue
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag23510 Product name: Recombinant human ECHDC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 37-90 aa of BC044574 Sequence: GPDQGITEILMNRPSARNALGNVFVSELLETLAQLREDRQVRVLLFRSGVKGVF Predict reactive species
Full Name: enoyl Coenzyme A hydratase domain containing 2
Observed Molecular Weight: 29-31 kDa
GenBank Accession Number: BC044574
Gene Symbol: ECHDC2
Gene ID (NCBI): 55268
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: Q86YB7
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924