Iright
BRAND / VENDOR: Proteintech

Proteintech, 86876-1-RR, ECHDC2 Recombinant monoclonal antibody

CATALOG NUMBER: 86876-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The ECHDC2 (86876-1-RR) by Proteintech is a Recombinant antibody targeting ECHDC2 in WB, ELISA applications with reactivity to human, mouse, rat samples 86876-1-RR targets ECHDC2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue, mouse heart tissue, rat heart tissue, human heart tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag23510 Product name: Recombinant human ECHDC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 37-90 aa of BC044574 Sequence: GPDQGITEILMNRPSARNALGNVFVSELLETLAQLREDRQVRVLLFRSGVKGVF Predict reactive species Full Name: enoyl Coenzyme A hydratase domain containing 2 Observed Molecular Weight: 29-31 kDa GenBank Accession Number: BC044574 Gene Symbol: ECHDC2 Gene ID (NCBI): 55268 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q86YB7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924