Iright
BRAND / VENDOR: Proteintech

Proteintech, 86895-1-RR, C1orf124 Recombinant monoclonal antibody

CATALOG NUMBER: 86895-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The C1orf124 (86895-1-RR) by Proteintech is a Recombinant antibody targeting C1orf124 in WB, ELISA applications with reactivity to human samples 86895-1-RR targets C1orf124 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Spartan (Protein with SprT-like domain at the N terminus), also known as DVC1 or C1orf124, is a replication-coupled DNA-dependent metalloprotease that cleaves proteins cross-linked to DNA to promote DPC repair (PMID: 38600235). Spartan protease activity is stimulated by DNA binding, while posttranslational modification of Spartan governs both its protease activity and recruitment to the DPC on chromatin (PMID: 27871366). The regulation of Spartan includes a ubiquitin switch (where deubiquitination activates its proteolytic activity), and acetylation and phosphorylation switches (which facilitate DNA binding). The calculated molecular weight of Spartan is 55 kDa, while the 65-kDa band could be due to posttranslational modification (PMID: 33567341, 31316063). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag20586 Product name: Recombinant human C1orf124 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-243 aa of BC015740 Sequence: MDDDLMLALRLQEEWNLQEAERDHAQESLSLVDASWELVDPTPDLQALFVQFNDQFFWGQLEAVEVKWSVRMTLCAGICSYEGKGGMCSIRLSEPLLKLRPRKDLVETLLHEMIHAYLFVTNNDKDREGHGPEFCKHMHRINSLTGANITVYHTFHDEVDEYRRHWWRCNGPCQHRPPYYGYVKRATNREPSAHDYWWAEHQKTCGGTYIKIKEPENYSKKGKGKAKLGKEPVLAAENKGTFV Predict reactive species Full Name: DNA-dependent metalloprotease SPRTN Calculated Molecular Weight: 489 aa, 55 kDa Observed Molecular Weight: 55/65 kDa GenBank Accession Number: BC015740 Gene Symbol: Spartan Gene ID (NCBI): 83932 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9H040 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924