Proteintech, 86916-1-RR, CCL20/MIP-3 alpha Recombinant monoclonal antibody

Size: 20ul / 100ul The CCL20/MIP-3 alpha (86916-1-RR) by Proteintech is a Recombinant antibody targeting CCL20/MIP-3 alpha in WB, ELISA applications with reactivity to mouse samples 86916-1-RR targets CCL20/MIP-3 alpha in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: Transfected with Mouse CCL20 Transfected HEK-293T cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information CCL20, also known as macrophage infiltrating factor protein 3α, is a C-C chemokine that specifically binds to the receptor CCR6. CCL20 is produced in various tissues and by a wide range of immune cells, including neutrophils, natural killer cells, T-helper type 17 (Th17) cells, B cells, and various antigen-presenting cells, such as dendritic cells (DCs), Langerhans cells, and macrophages. Increased expression of CCL20 is likely involved in the increased recruitment of dendritic cells observed in fibroinflammatory diseases such as chronic obstructive pulmonary disease (COPD). CCL20 expression is increased by the proinflammatory cytokine IL-1 beta. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3311 Product name: Recombinant Mouse CCL20/MIP-3 alpha protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 28-96 aa of NM_001159738.1 Sequence: SNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM Predict reactive species Full Name: chemokine (C-C motif) ligand 20 Calculated Molecular Weight: 11KD GenBank Accession Number: NM_001159738.1 Gene Symbol: Ccl20 Gene ID (NCBI): 20297 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q642U4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.