Iright
BRAND / VENDOR: Proteintech

Proteintech, 86958-2-RR, TRBC1 Recombinant monoclonal antibody

CATALOG NUMBER: 86958-2-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The TRBC1 (86958-2-RR) by Proteintech is a Recombinant antibody targeting TRBC1 in WB, IF/ICC, ELISA applications with reactivity to human samples 86958-2-RR targets TRBC1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information TRBC1 (T-cell receptor beta constant 1) is a protein encoded by the TRBC1 gene. It constitutes one of the two beta-chain constant regions (TRBC1 and TRBC2) within the T-cell receptor (TCR) complex, which is essential for adaptive immune responses . Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg7272 Product name: Recombinant human TRBC1 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 1-129 aa of / Sequence: DLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD Predict reactive species Full Name: T cell receptor beta constant 1 Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: / Gene Symbol: TRBC1 Gene ID (NCBI): 28639 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P01850 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924