Proteintech, 86963-1-RR, MYST3 Recombinant monoclonal antibody

Size: 20ul / 100ul The MYST3 (86963-1-RR) by Proteintech is a Recombinant antibody targeting MYST3 in WB, IF/ICC, ELISA applications with reactivity to human samples 86963-1-RR targets MYST3 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-10A cells, BT-474 cells Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag29729 Product name: Recombinant human MYST3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 420-510 aa of BC142659 Sequence: SPDGRKARGEVVDYSEQYRIRKRGNRKSSTSDWPTDNQDGWDGKQENEERLFGSQEIMTEKDMELFRDIQEQALQKVGVTGPPDPQVRCPS Predict reactive species Full Name: MYST histone acetyltransferase (monocytic leukemia) 3 Calculated Molecular Weight: 2004 aa, 225 kDa Observed Molecular Weight: 310 kDa GenBank Accession Number: BC142659 Gene Symbol: MYST3 Gene ID (NCBI): 7994 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q92794 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.