Proteintech, 86980-1-RR, FAM160B1 Recombinant monoclonal antibody

Size: 20ul / 100ul The FAM160B1 (86980-1-RR) by Proteintech is a Recombinant antibody targeting FAM160B1 in WB, ELISA applications with reactivity to human samples 86980-1-RR targets FAM160B1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human testis tissue, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information FAM160B1, also named as KIAA1600, is a 765 amino acid protein, which belongs to the UPF0518 family. The biological function of FAM160B1is still non-known. FAM160B1 exists as two isoforms and the molecular weight of isoform one is a 86 kDa protein.The isoforms two is produced by alternative splicing and is a 83 kDa protein. There are modified residues of FAM160B1 protein, so we detected 95 kDa and 100 kDa two bands by western blotting. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag22051 Product name: Recombinant human FAM160B1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 136-319 aa of BC037207 Sequence: IRLCGEVLATPTENEEIQFLCIVCAKLKQDPYLVNFFLENKMKSLASKGVPNVISEDTLKGQDSLSTDTGQSRQPEELSGATGMEQTELEDEPPHQMDHLSTSLDNLSVTSLPEASVVCPNQDYNLVNSLLNLTRSPDGRIAVKACEGLMLLVSLPEPAAAKCLTQSTCLCELLTDRLASLYKA Predict reactive species Full Name: family with sequence similarity 160, member B1 Calculated Molecular Weight: 765 aa, 86 kDa Observed Molecular Weight: 100, 130 kDa GenBank Accession Number: BC037207 Gene Symbol: FAM160B1 Gene ID (NCBI): 57700 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q5W0V3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.