Proteintech, 87005-3-RR, Vitronectin/S-protein Recombinant monoclonal antibody

Size: 20ul / 100ul The Vitronectin/S-protein (87005-3-RR) by Proteintech is a Recombinant antibody targeting Vitronectin/S-protein in WB, ELISA applications with reactivity to human, rat samples 87005-3-RR targets Vitronectin/S-protein in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: human plasma, rat plasma Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Vitronectin is a glycoprotein present in blood and in the extracellular matrix (PMID: 10399314). Vitronectin is a multifunctional glycoprotein that mediates cell-to-substrate adhesion, inhibits the cytolytic action of the terminal complement cascade in vitro and binds to several serine protease inhibitors of the serpin family (PMID: 1372588). Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4682 Product name: Recombinant human Vitronectin protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 20-478 aa of NM_000638.4 Sequence: DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL Predict reactive species Full Name: vitronectin Calculated Molecular Weight: 54 kDa Observed Molecular Weight: 70-75 kDa GenBank Accession Number: NM_000638.4 Gene Symbol: VTN Gene ID (NCBI): 7448 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P04004 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.