Proteintech, 87016-1-RR, P130 Recombinant monoclonal antibody

Size: 20ul / 100ul The P130 (87016-1-RR) by Proteintech is a Recombinant antibody targeting P130 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 87016-1-RR targets P130 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, rat brain tissue, K-562 cells, HeLa cells, Caki-1 cells, HEK-293 cells, Sp2/0 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information Nucleolar and coiled-body phosphoprotein 1 (NOLC1) is a phosphoprotein that transiently associates with the mature nucleolar H/ACA and C/D box small nucleolar ribonucleoproteins (snoRNPs), guiding site-specific 2'-O-meth-ylation and pseudouridylation of pre-rRNAs [PMID:21266110]. It contains a nuclear localization signal binding sequence and is thought to shuttle between the nucleolus and the cytoplasm. NOLC1 plays an essential role in the synthesis of rRNA and the biosynthesis of ribosomes [PMID:8972203]. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2382 Product name: Recombinant human P130 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 69-418 aa of BC006769 Sequence: TKPPPAKKAAESSSDSSDSDSSEDDEAPSKPAGTTKNSSNKPAVTTKSPAVKPAAAPKQPVGGGQKLLTRKADSSSSEEESSSSEEEKTKKMVATTKPKATAKAALSLPAKQAPQGSRDSSSDSDSSSSEEEEEKTSKSAVKKKPQKVAGGAAPSKPASAKKGKAESSNSSSSDDSSEEEEEKLKGKGSPRPQAPKANGTSALTAQNGKAAKNSEEEEEEKKKAAVVVSKSGSLKKRKQNEAAKEAETPQAKKIKLQTPNTFPKRKKGEKRASSPFRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQVNSIKFDSE Predict reactive species Full Name: nucleolar and coiled-body phosphoprotein 1 Calculated Molecular Weight: 73 kDa Observed Molecular Weight: 120-130 kDa GenBank Accession Number: BC006769 Gene Symbol: NOLC1 Gene ID (NCBI): 9221 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q14978 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.