Proteintech, 87039-1-RR, SNX27 Recombinant monoclonal antibody

Size: 20ul / 100ul The SNX27 (87039-1-RR) by Proteintech is a Recombinant antibody targeting SNX27 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 87039-1-RR targets SNX27 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells, HeLa cells, Jurkat cells, HEK-293 cells, 3T3-L1 cells, NIH/3T3 cells, HSC-T6 cells Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Sorting nexin 27 (SNX27), a PDZ domain-containing protein, belongs to the sorting nexin family of proteins. SNX27 promotes the recycling of internalized transmembrane proteins from endosomes to the plasma membrane by linking PDZ-dependent cargo recognition to retromer-mediated transport (PMID: 21602791; 23563491). It has been shown that SNX27 deficiency contributes to synaptic and cognitive deficits by modulating glutamate receptor recycling in Down's syndrome (PMID: 23524343). SNX27 has also been proposed to have a role in regulating β-amyloid (Aβ) generation by modulating γ-secretase activity, which is a molecular mechanism for Aβ-dependent pathogenesis in both Down's syndrome and Down's syndrome (PMID: 25437557). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag29226 Product name: Recombinant human SNX27 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC012184 Sequence: MDSTTVNYFALFEVISHSFVRKLAPNEFPHKLYIQNYTSAVPGTCLTIRKWLFTTEEEILLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSYQLQKLYEQR Predict reactive species Full Name: sorting nexin family member 27 Calculated Molecular Weight: 61 kDa, 60 kDa, 52 kDa, 28 kDa Observed Molecular Weight: 61 kDa GenBank Accession Number: BC012184 Gene Symbol: SNX27 Gene ID (NCBI): 81609 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96L92 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.