Proteintech, 87049-1-RR, OTUD6B Recombinant monoclonal antibody

Size: 20ul / 100ul The OTUD6B (87049-1-RR) by Proteintech is a Recombinant antibody targeting OTUD6B in WB, IF/ICC, ELISA applications with reactivity to human samples 87049-1-RR targets OTUD6B in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, HEK-293T cells, A431 cells, Raji cells Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information OTUD6B, also known as DUBA5, belongs to a DUB subfamily characterized by an ovarian tumor domain (OTU). It's a functional deubiquitinating enzyme, a class of protease that specifically cleaves ubiquitin linkages. OTUD6B function may be connected to growth and proliferation. It has been reported that OTUD6B could significantly suppress HCC cells migration and metastasis. The calculated molecular weight of OTUD6B is 34 kDa, 87049-1-RR can detect the band around 34 kDa.(PMID:32323143) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag22044 Product name: Recombinant human OTUD6B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-157 aa of BC029760 Sequence: MEAVLTEELDEEEQLLRRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEKEMEQKHREELEQLKLTTKENKIDSVAVNISNLVLENQPPRISKAQKRREKKAALEKEREERIAEAEIENLTGARHMESEKLAQILAARQLEIKQIPSDGH Predict reactive species Full Name: OTU domain containing 6B Calculated Molecular Weight: 293 aa, 34 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC029760 Gene Symbol: OTUD6B Gene ID (NCBI): 51633 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8N6M0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.