Proteintech, 87051-3-RR, SOX10 Recombinant monoclonal antibody

Size: 20ul / 100ul The SOX10 (87051-3-RR) by Proteintech is a Recombinant antibody targeting SOX10 in WB, IF/ICC, ELISA applications with reactivity to human, rat samples 87051-3-RR targets SOX10 in WB, IF/ICC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: MDA-MB-453 cells, A375 cells, SW480 cells, C6 cells Positive IF/ICC detected in: A375 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information Sox10 is a transcription factor that has a crucial role in complex signalling pathways regulating central nervous system and neural crest development. The calcualted molecular weight of SOX10 is 50 kDa, but modified SOX10 is about 55-65 kDa. (PMID: 23799842, 39982575) Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag38090 Product name: Recombinant human SOX10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 267-466 aa of BC002824 Sequence: GKPHIDFGNVDIGEISHEVMSNMETFDVAELDQYLPPNGHPGHVSSYSAAGYGLGSALAVASGHSAWISKPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPTHWEQPVYTTLSRP Predict reactive species Full Name: SRY (sex determining region Y)-box 10 Calculated Molecular Weight: 50 kDa Observed Molecular Weight: 50-65 kDa GenBank Accession Number: BC002824 Gene Symbol: SOX10 Gene ID (NCBI): 6663 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P56693 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.