Iright
BRAND / VENDOR: Proteintech

Proteintech, 87054-1-RR, SAP30BP Recombinant monoclonal antibody

CATALOG NUMBER: 87054-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SAP30BP (87054-1-RR) by Proteintech is a Recombinant antibody targeting SAP30BP in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 87054-1-RR targets SAP30BP in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, A549 cells, Jurkat cells, HEK-293T cells, mouse spleen tissue, rat spleen tissue, mouse kidney tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information SAP30BP, also named as SAP30-binding protein, is a 308 amino acid protein, which belongs to the HCNGP family. SAP30BP localizes in Nucleus and Interacts with SAP30. DDX54 Induces cell death and may act as a transcriptional corepressor of a gene related to cell survival. SAP30BP may be involved in the regulation of beta-2-microglobulin genes. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag15051 Product name: Recombinant human SAP30BP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-308 aa of BC007592 Sequence: MAGKKNVLSSLAVYAEDSEPESDGEAGIEAVGSAAEEKGGLVSDAYGEDDFSRLGGDEDGYEEEEDENSRQSEDDDSETEKPEADDPKDNTEAEKRDPQELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYERKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYPKDMFDPHGWSEDSYYEALAKAQKIEMDKLEKAKKERTKIEFVTGTKKGTTTNATSTTTTTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPAVVTVTTSASGSKTTVISAVGTIVKKAKQ Predict reactive species Full Name: SAP30 binding protein Calculated Molecular Weight: 308 aa, 34 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC007592 Gene Symbol: SAP30BP Gene ID (NCBI): 29115 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UHR5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924