Proteintech, 87060-4-RR, CCL5 Recombinant monoclonal antibody

Size: 20ul / 100ul The CCL5 (87060-4-RR) by Proteintech is a Recombinant antibody targeting CCL5 in WB, ELISA applications with reactivity to mouse samples 87060-4-RR targets CCL5 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: PMA, LPS and Brefeldin A treated RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information CCL5 (C-C motif chemokine ligand 5), also known as RANTES, is a key inflammatory chemokine that attracts immune cells like T cells, monocytes, and eosinophils to sites of infection or inflammation, playing vital roles in immunity, viral defense (including HIV), and sometimes cancer progression, by binding to receptors like CCR1, CCR3, and CCR5 to signal cell movement and activation, with inhibitors being researched for therapeutic use. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2253 Product name: Recombinant Mouse CCL5 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 24-91 aa of Q5XZF2 Sequence: SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS Predict reactive species Full Name: chemokine (C-C motif) ligand 5 Calculated Molecular Weight: 10kd Observed Molecular Weight: 8 kDa GenBank Accession Number: Q5XZF2 Gene Symbol: Ccl5 Gene ID (NCBI): 20304 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P30882 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.