Iright
BRAND / VENDOR: Proteintech

Proteintech, 87090-3-RR, AK3 Recombinant monoclonal antibody

CATALOG NUMBER: 87090-3-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The AK3 (87090-3-RR) by Proteintech is a Recombinant antibody targeting AK3 in WB, ELISA applications with reactivity to human, mouse, rat samples 87090-3-RR targets AK3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, L02 cells, Y79 cells, mouse kidney tissue, mouse heart tissue, mouse liver tissue, rat kidney tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information AK3(Adenylate kinase 3) is also named as AK3L1, AK6, AKL3L and belongs to the adenylate kinase family. It is located in the mitochondrial matrix and is a GTP:AMP phosphotransferase(PMID:2546792). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3146 Product name: Recombinant human AK3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-227 aa of BC013771 Sequence: MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP Predict reactive species Full Name: adenylate kinase 3 Calculated Molecular Weight: 227 aa, 26 kDa Observed Molecular Weight: 26-30 kDa GenBank Accession Number: BC013771 Gene Symbol: AK3 Gene ID (NCBI): 50808 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UIJ7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924