Proteintech, 87094-1-RR, IL-17B Recombinant monoclonal antibody

Size: 20ul / 100ul The IL-17B (87094-1-RR) by Proteintech is a Recombinant antibody targeting IL-17B in WB, ELISA applications with reactivity to mouse samples 87094-1-RR targets IL-17B in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: Recombinant protein, Transfected with Mouse Il17b Transfected HEK-293T cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information The interleukin (IL)-17 superfamily, a relatively new family of cytokines, consists of six ligands (from IL-17A to IL-17F), which bind to five receptor subtypes (from IL-17RA to IL-17RE) and induce downstream signaling. IL-17B was originally described as increased during intestinal inflammation. Moreover, it stimulates TNF-α and IL-1β production by the human monocytic leukemia THP-1 cells and promotes neutrophil migration upon intraperitoneal administration, suggesting a pro-inflammatory role. More recent findings strongly suggest a role for the IL-17B/IL-17RB pathway in tumorigenesis. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2785 Product name: recombinant mouse Il17b protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 23-180 aa of NM_019508.1 Sequence: RNTKGKRKGQGRPSPLAPGPHQVPLDLVSRVKPYARMEEYERNLGEMVAQLRNSSEPAKKKCEVNLQLWLSNKRSLSPWGYSINHDPSRIPADLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPQPPRPGPCRQRVVMETIAVGCTCIF Predict reactive species Full Name: interleukin 17B Calculated Molecular Weight: 20 kDa GenBank Accession Number: NM_019508.1 Gene Symbol: Il17b Gene ID (NCBI): 56069 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9QXT6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.