Iright
BRAND / VENDOR: Proteintech

Proteintech, 87100-1-RR, Apolipoprotein CIII Recombinant monoclonal antibody

CATALOG NUMBER: 87100-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The Apolipoprotein CIII (87100-1-RR) by Proteintech is a Recombinant antibody targeting Apolipoprotein CIII in WB, IF/ICC, ELISA applications with reactivity to human samples 87100-1-RR targets Apolipoprotein CIII in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma, human serum Positive IF/ICC detected in: L02 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Apolipoprotein CIII (apoCIII) is the most abundant C-apolipoprotein in human and is found on very low density lipoproteins, chylomicrons, and high density lipoproteins (HDL) (PMID: 18408013). ApoCIII inhibits lipoprotein lipase as well as binding of lipoproteins to cell surface heparan sulfate proteoglycans and receptors (PMID: 26228667). ApoC-III has 3 actions that can impair plasma lipoprotein metabolism and lead to hypertriglyceridemia (PMID: 24941081). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3387 Product name: recombinant human APOC3 protein Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 21-99 aa of NM_000040 Sequence: SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA Predict reactive species Full Name: apolipoprotein C-III Calculated Molecular Weight: 11 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: NM_000040 Gene Symbol: Apolipoprotein CIII Gene ID (NCBI): 345 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P02656 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924