Product Description
Size: 20ul / 100ul
The Apolipoprotein CIII (87100-1-RR) by Proteintech is a Recombinant antibody targeting Apolipoprotein CIII in WB, IF/ICC, ELISA applications with reactivity to human samples
87100-1-RR targets Apolipoprotein CIII in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: human plasma, human serum
Positive IF/ICC detected in: L02 cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Background Information
Apolipoprotein CIII (apoCIII) is the most abundant C-apolipoprotein in human and is found on very low density lipoproteins, chylomicrons, and high density lipoproteins (HDL) (PMID: 18408013). ApoCIII inhibits lipoprotein lipase as well as binding of lipoproteins to cell surface heparan sulfate proteoglycans and receptors (PMID: 26228667). ApoC-III has 3 actions that can impair plasma lipoprotein metabolism and lead to hypertriglyceridemia (PMID: 24941081).
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Eg3387 Product name: recombinant human APOC3 protein Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 21-99 aa of NM_000040 Sequence: SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA Predict reactive species
Full Name: apolipoprotein C-III
Calculated Molecular Weight: 11 kDa
Observed Molecular Weight: 11 kDa
GenBank Accession Number: NM_000040
Gene Symbol: Apolipoprotein CIII
Gene ID (NCBI): 345
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: P02656
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924