Iright
BRAND / VENDOR: Proteintech

Proteintech, 87109-1-RR, Complement Factor I Recombinant monoclonal antibody

CATALOG NUMBER: 87109-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The Complement Factor I (87109-1-RR) by Proteintech is a Recombinant antibody targeting Complement Factor I in WB, ELISA applications with reactivity to human samples 87109-1-RR targets Complement Factor I in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, HuH-7 cells, U-251 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Complement Factor I (CFI) protein is a key plasma serine protease, which is mainly synthesized in the liver, with a molecular weight of about 75-80 kDa, and circulates in the blood in the form of heterodimers of heavy chain (51 kDa)- light chain (37 kDa) disulfide bonds. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3066 Product name: recombinant human CFI protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 19-583 aa of NM_000204.5 Sequence: KVTYTSQEDLVEKKCLAKKYTHLSCDKVFCQPWQRCIEGTCVCKLPYQCPKNGTAVCATNRRSFPTYCQQKSLECLHPGTKFLNNGTCTAEGKFSVSLKHGNTDSEGIVEVKLVDQDKTMFICKSSWSMREANVACLDLGFQQGADTQRRFKLSDLSINSTECLHVHCRGLETSLAECTFTKRRTMGYQDFADVVCYTQKADSPMDDFFQCVNGKYISQMKACDGINDCGDQSDELCCKACQGKGFHCKSGVCIPSQYQCNGEVDCITGEDEVGCAGFASVTQEETEILTADMDAERRRIKSLLPKLSCGVKNRMHIRRKRIVGGKRAQLGDLPWQVAIKDASGITCGGIYIGGCWILTAAHCLRASKTHRYQIWTTVVDWIHPDLKRIVIEYVDRIIFHENYNAGTYQNDIALIEMKKDGNKKDCELPRSIPACVPWSPYLFQPNDTCIVSGWGREKDNERVFSLQWGEVKLISNCSKFYGNRFYEKEMECAGTYDGSIDACKGDSGGPLVCMDANNVTYVWGVVSWGENCGKPEFPGVYTKVANYFDWISYHVGRPFISQYNV Predict reactive species Full Name: complement factor I Calculated Molecular Weight: 66 kDa Observed Molecular Weight: 75-80 kDa GenBank Accession Number: NM_000204.5 Gene Symbol: CFI Gene ID (NCBI): 3426 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P05156 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924