Proteintech, 87115-2-RR, STAC2 Recombinant monoclonal antibody

Size: 20ul / 100ul The STAC2 (87115-2-RR) by Proteintech is a Recombinant antibody targeting STAC2 in WB, ELISA applications with reactivity to human samples 87115-2-RR targets STAC2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SH-SY5Y cells, K-562 cells, THP-1 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information STAC2 (Src homology 3 and cysteine-rich domain 2) contains an SH3 domain and a zinc finger domain. STAC2 has been shown to negatively regulate osteoclast formation by targeting the RANK signaling complex. This mechanism involves inhibiting the formation of complexes containing Gab2 and PLCγ2, thereby suppressing NF-κB and MAPK signaling pathways. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag16601 Product name: Recombinant human STAC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 65-154 aa of BC109231 Sequence: TLRYGTSLALMNRSSFSSTSESPTRSLSERDELTEDGEGSIRSSEEGPGDSASPVFTAPAESEGPGPEEKSPGQQLPKATLRKDVGPMYS Predict reactive species Full Name: SH3 and cysteine rich domain 2 Calculated Molecular Weight: 411 aa, 45 kDa Observed Molecular Weight: 55-57 kDa GenBank Accession Number: BC109231 Gene Symbol: STAC2 Gene ID (NCBI): 342667 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q6ZMT1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.