Proteintech, 87119-3-RR, p107 Recombinant monoclonal antibody

Size: 20ul / 100ul The p107 (87119-3-RR) by Proteintech is a Recombinant antibody targeting p107 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 87119-3-RR targets p107 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HCT 116 cells, MCF-7 cells, A431 cells, mouse testis tissue, rat testis tissue Positive IP detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Retinoblastoma-like protein 1, also named RBL1, p107, is a member of E1A-binding proteins, which contains a A/B pocket, or pRb. Via this structure, RBL1 can bind to viral oncoproteins and other perteins containing LXCXE motif. It regulates cell proliferation via phosphorylation-sensitive interactions with E2F transcription factors and other proteins. Key regulator of entry into cell division. Directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation. Recruits and targets histone methyltransferases SUV420H1 and SUV420H2, leading to epigenetic transcriptional repression.(uniprot). It has been reported there are two transcirpts variants of RBL1, which encode a 119-kd protein and a 68-kd protein(PMID:7490090). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4146 Product name: Recombinant human RBL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC032247 Sequence: MFEDKPHAEGAAVVAAAGEALQALCQELNLDEGSAAEALDDFTAIRGNYSLEGEVTHWLACSLYVACRKSIIPTVGKGIMEGNCVSLTRILRSAKLSLIQFFSKMKKWMDMSNLPQEFRERIERLERNFEVSTVIFKKYEPIFLDIFQNPYEEPPKLPRSRKQRRIPCSVKDLFNFCWTLFVYTKGNFRMIGDDLVNSYHLLLCCLDLIFANAIMCPNRQDLLNPSFKGLPSDFHTADFTASEEPPCIIAVLCELHDGLLVEAKGIKEHYFKPYISKLFDRKILKGECLLDLSSFTDNSKAVNKEYEEYVLTVGDFDERIFLGADAEEEIGTPRKFTRDTPLGKLTAQANV Predict reactive species Full Name: retinoblastoma-like 1 (p107) Calculated Molecular Weight: 1068 aa, 119 kDa Observed Molecular Weight: 119 kDa GenBank Accession Number: BC032247 Gene Symbol: p107 Gene ID (NCBI): 5933 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P28749 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.