Iright
BRAND / VENDOR: Proteintech

Proteintech, 87128-4-RR, PSMC3 Recombinant monoclonal antibody

CATALOG NUMBER: 87128-4-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PSMC3 (87128-4-RR) by Proteintech is a Recombinant antibody targeting PSMC3 in WB, IF/ICC, ELISA applications with reactivity to human samples 87128-4-RR targets PSMC3 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, Jurkat cells, T-47D cells, U2OS cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag21408 Product name: Recombinant human PSMC3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-200 aa of BC008713 Sequence: MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDERPTEQYSDIGGLDKQIQELVE Predict reactive species Full Name: proteasome (prosome, macropain) 26S subunit, ATPase, 3 Calculated Molecular Weight: 49 kDa Observed Molecular Weight: 49 kDa GenBank Accession Number: BC008713 Gene Symbol: PSMC3 Gene ID (NCBI): 5702 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P17980 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924