Proteintech, 87158-1-RR, CAPN3 Recombinant monoclonal antibody

Size: 20ul / 100ul The CAPN3 (87158-1-RR) by Proteintech is a Recombinant antibody targeting CAPN3 in WB, ELISA applications with reactivity to human, mouse, rat, pig samples 87158-1-RR targets CAPN3 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, rat skeletal muscle tissue, human skeletal muscle tissue, pig skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Calpain 3 (CAPN3), a major intracellular protease, is a muscle-specific member of the calpain large subunit family that specifically binds to titin. CAPN3 plays a role in the dysferlin protein complex and that disruption of CAPN3 function may affect muscle membrane repair and remodeling. CAPN3 has some isoforms with MW of 94, 84, 93, 36, 18 kDa. CAPN3 autolysis generates a small N-terminal fragment of 34 kDa and a large C-terminal fragment whose size ranges from 55 to 60 kDa during self-processing (PMID: 9794799, 14645524). Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0671 Product name: Recombinant human CAPN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-156 aa of BC003521 Sequence: MEICADELKKVLNTVVNKHKDLKTHGFTLESCRSMIALMDTDGSGKLNLQEFHHLWNKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA Predict reactive species Full Name: calpain 3, (p94) Calculated Molecular Weight: 94 kDa Observed Molecular Weight: 90-105 kDa, 55-60 kDa, 30-35 kDa GenBank Accession Number: BC003521 Gene Symbol: CAPN3 Gene ID (NCBI): 825 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P20807 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.