Proteintech, 87166-1-RR, HERC5 Recombinant monoclonal antibody

Size: 20ul / 100ul The HERC5 (87166-1-RR) by Proteintech is a Recombinant antibody targeting HERC5 in WB, IF/ICC, ELISA applications with reactivity to human samples 87166-1-RR targets HERC5 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, A549 cells, Jurkat cells, U-251 cells Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information HERC5 (HECT and RLD domain-containing E3 ubiquitin ligase 5) is constitutively expressed at low or undetectable levels in most normal adult tissues and in a subset of cancer cell lines. It is an evolutionarily ancient restriction factor that inhibits the replication of diverse viruses. By virtue of its C-terminal HECT domain, HERC5 is the main cellular E3 ligase for conjugating ISG15 to substrates and localizes to polyribosomes to modify newly translated viral proteins, thereby disrupting key aspects of viral particle production. E3 ligase-independent antiviral activity has also been demonstrated towards HIV-1, where it inhibits the nuclear export of incompletely-spliced viral RNAs by a mechanism requiring its N-terminal RCC1-like domain (RLD). (PMID: 34572049) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag33511 Product name: Recombinant human HERC5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 160-342 aa of BC140716 Sequence: FAWGQNLHGQLGVGRKFPSTTTPQIVEHLAGVPLAQISAGEAHSMALSMSGNIYSWGKNECGQLGLGHTESKDDPSLIEGLDNQKVEFVACGGSHSALLTQDGLLFTFGAGKHGQLGHNSTQNELRPCLVAELVGYRVTQIACGRWHTLAYVSDLGKVFSFGSGKDGQLGNGGTRDQLMPLPV Predict reactive species Full Name: hect domain and RLD 5 Calculated Molecular Weight: 1024 aa, 117 kDa Observed Molecular Weight: 117 kDa GenBank Accession Number: BC140716 Gene Symbol: HERC5 Gene ID (NCBI): 51191 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UII4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.