Iright
BRAND / VENDOR: Proteintech

Proteintech, 87178-5-RR, RAB27A Recombinant monoclonal antibody

CATALOG NUMBER: 87178-5-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The RAB27A (87178-5-RR) by Proteintech is a Recombinant antibody targeting RAB27A in WB, ELISA applications with reactivity to human samples 87178-5-RR targets RAB27A in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells, Jurkat cells, K-562 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Rab27A is a member of a large family of Ras-related small GTPases. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Recent studies suggest that Rab27A is associated with melanosomes in pigmented cells and regulates melanosome transport via its interaction with actin-based cellular motors such as myosin Va and myosin VIIa. RAB27A is also required for regulated secretion in cytotoxic T lymphocytes. Rab27A is implicated in several diseases, including Griscelli syndrome, choroideremia, and the Hermansky-Pudlak syndrome mouse model, gunmetal. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag12136 Product name: Recombinant human RAB27A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-221 aa of BC107680 Sequence: MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC Predict reactive species Full Name: RAB27A, member RAS oncogene family Calculated Molecular Weight: 221 aa, 25 kDa Observed Molecular Weight: 25-27 kDa GenBank Accession Number: BC107680 Gene Symbol: RAB27A Gene ID (NCBI): 5873 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P51159 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924