Proteintech, 87198-1-RR, SEC10/EXOC5 Recombinant monoclonal antibody

Size: 20ul / 100ul The SEC10/EXOC5 (87198-1-RR) by Proteintech is a Recombinant antibody targeting SEC10/EXOC5 in WB, ELISA applications with reactivity to human, mouse, rat samples 87198-1-RR targets SEC10/EXOC5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293T cells, Jurkat cells, A549 cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information The exocyst complex, composed of eight evolutionarily conserved subunits (SEC3, SEC5, SEC6, SEC8, SEC10, SEC15, EXO70, and EXO84), is essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. The complex is also essential for the biogenesis of epithelial cell surface polarity. SEC10, as a central component of the eight-protein exocyst complex, plays a crucial role in exocytosis. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag11524 Product name: Recombinant human SEC10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 359-708 aa of BC041126 Sequence: SRSAMILQRYYDSKNHQKRSIGTGGIQDLKERIRQRTNLPLGPSIDTHGETFLSQEVVVNLLQETKQAFERCHRLSDPSDLPRNAFRIFTILVEFLCIEHIDYALETGLAGIPSSDSRNANLYFLDVVQQANTIFHLFDKQFNDHLMPLISSSPKLSECLQKKKEIIEQMEMKLDTGIDRTLNCMIRQMKHILAAEQKKTDFKPEDENNVLIQYTNACVKVCAYVRKQVEKIKNSMDGKNVDTVLMELGVRFHRLIYEHLQQYSYSCMGGMLAICDVAEYRKCAKDFKIPMVLHLFDTLHALCNLLVVAPDNLKQVCSGEQLANLDKNILHSFVQLRADYRSARLARHFS Predict reactive species Full Name: exocyst complex component 5 Calculated Molecular Weight: 708 aa, 82 kDa Observed Molecular Weight: 70-77 kDa GenBank Accession Number: BC041126 Gene Symbol: EXOC5 Gene ID (NCBI): 10640 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O00471 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.