Iright
BRAND / VENDOR: Proteintech

Proteintech, 87210-1-RR, SLC12A1 Recombinant monoclonal antibody

CATALOG NUMBER: 87210-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SLC12A1 (87210-1-RR) by Proteintech is a Recombinant antibody targeting SLC12A1 in WB, ELISA applications with reactivity to human, mouse samples 87210-1-RR targets SLC12A1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: 37°C incubated mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5325 Product name: Recombinant human SLC12A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-176 aa of BC040138 Sequence: MSLNNSSNVFLDSVPSNTNRFQVSVINENHESSAAADDNTDPPHYEETSFGDEAQKRLRISFRPGNQECYDNFLQSGETAKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGSISGPKVNRPSLLEIHEQLAKNVAVTPSSADRVANGDGIPGDEQAENKEDDQAGVVK Predict reactive species Full Name: solute carrier family 12 (sodium/potassium/chloride transporters), member 1 Calculated Molecular Weight: 121 kDa Observed Molecular Weight: 140-180 kDa GenBank Accession Number: BC040138 Gene Symbol: SLC12A1/NKCC2 Gene ID (NCBI): 6557 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13621 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924