Proteintech, 87233-1-RR, PFKFB3 Recombinant monoclonal antibody

Size: 20ul / 100ul The PFKFB3 (87233-1-RR) by Proteintech is a Recombinant antibody targeting PFKFB3 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 87233-1-RR targets PFKFB3 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, rat thymus tissue, Jurkat cells, HEK-293 cells, mouse spleen tissue Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information PFKFB3, also named as NY-REN-56 and iPFK-2, plays a role in glucose metabolism. Its synthesis and degradation of fructose 2,6-bisphosphate. Endogenously generated adenosine cooperates with bacterial components to increase PFKFB3 isozyme activity, resulting in greater fructose 2,6-bisphosphate accumulation. PFKFB3 is required for increased growth, metabolic activity and is regulated through active JAK2 and STAT5. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4744 Product name: Recombinant human PFKFB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 243-520 aa of BC040482 Sequence: HVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQLKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTGESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH Predict reactive species Full Name: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 Calculated Molecular Weight: 520 aa, 60 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC040482 Gene Symbol: PFKFB3 Gene ID (NCBI): 5209 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q16875 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.