Proteintech, 87243-1-RR, LIPC Recombinant monoclonal antibody

Size: 20ul / 100ul The LIPC (87243-1-RR) by Proteintech is a Recombinant antibody targeting LIPC in WB, ELISA applications with reactivity to human, mouse, rat samples 87243-1-RR targets LIPC in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, HepG2 cells, HuH-7 cells, rat liver tissue, mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information LIPC, also named as HTGL and HL, belongs to the AB hydrolase superfamily and Lipase family. It has the capacity to catalyze hydrolysis of phospholipids, mono-, di-, and triglycerides, and acyl-CoA thioesters. LIPC is an important enzyme in HDL metabolism. It binds heparin. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag15538 Product name: Recombinant human LIPC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 213-463 aa of BC146659 Sequence: DASFVDAIHTFTREHMGLSVGIKQPIGHYDFYPNGGSFQPGCHFLELYRHIAQHGFNAITQTIKCSHERSVHLFIDSLLHAGTQSMAYPCGDMNSFSQGLCLSCKKGRCNTLGYHVRQEPRSKSKRLFLVTRAQSPFKVYHYQLKIQFINQTETPIQTTFTMSLLGTKEKMQKIPITLGKGIASNKTYSFLITLDVDIGELIMIKFKWENSAVWANVWDTVQTIIPWSTGPRHSGLVLKTIRVKAGETQQR Predict reactive species Full Name: lipase, hepatic Calculated Molecular Weight: 499 aa, 56 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC146659 Gene Symbol: LIPC Gene ID (NCBI): 3990 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P11150 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.