Iright
BRAND / VENDOR: Proteintech

Proteintech, 87244-1-RR, HSD11B2 Recombinant monoclonal antibody

CATALOG NUMBER: 87244-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The HSD11B2 (87244-1-RR) by Proteintech is a Recombinant antibody targeting HSD11B2 in WB, ELISA applications with reactivity to human, mouse, rat samples 87244-1-RR targets HSD11B2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, COLO 320 cells, HT-29 cells, Caco-2 cells, rat kidney tissue, human kidney tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information The HSD11B2 gene encodes the type II isoform of 11-beta-hydroxysteroid dehydrogenase, a microsomal enzyme complex responsible for the interconversion of biologically active cortisol and inactive cortisone. This protein catalyzes the cortisol-to-cortisone reaction. This protein expresses approximately 44 kDa in placenta, trophoblast, and distal colon, but in kidney tissue, there are two bands of approximately 44 and 48 kDa can be consistently observed and no signal is seen in decidua, adrenal, or liver(PMID:9048640). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5146 Product name: Recombinant human HSD11B2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-405 aa of BC036780 Sequence: MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAVLAAAGWIALSRLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPGAIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELSPVATFRSCMEVNFFGALELTKGLLPLLRSSRGRIVTVGSPAGDMPYPCLGAYGTSKAAVALLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYIEHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRRRFLQAFFISHCLPRALQPGQPGTTPPQDAAQGPNLSPGPSPAVAR Predict reactive species Full Name: hydroxysteroid (11-beta) dehydrogenase 2 Calculated Molecular Weight: 405 aa, 44 kDa Observed Molecular Weight: 40-43 kDa GenBank Accession Number: BC036780 Gene Symbol: HSD11B2 Gene ID (NCBI): 3291 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P80365 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924