Iright
BRAND / VENDOR: Proteintech

Proteintech, 87280-1-RR, COL8A1 Recombinant monoclonal antibody

CATALOG NUMBER: 87280-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The COL8A1 (87280-1-RR) by Proteintech is a Recombinant antibody targeting COL8A1 in WB, ELISA applications with reactivity to human samples 87280-1-RR targets COL8A1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: NCI-H1299 cells, U-251 cells, 5637 cells, A172 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag10607 Product name: Recombinant human COL8A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 396-744 aa of BC013581 Sequence: GIPGPMGPPGAIGFPGPKGEGGIVGPQGPPGPKGEPGLQGFPGKPGFLGEVGPPGMRGLPGPIGPKGEAGQKGVPGLPGVPGLLGPKGEPGIPGDQGLQGPPGIPGIGGPSGPIGPPGIPGPKGEPGLPGPPGFPGIGKPGVAGLHGPPGKPGALGPQGQPGLPGPPGPPGPPGPPAVMPPTPPPQGEYLPDMGLGIDGVKPPHAYGAKKGKNGGPAYEMPAFTAELTAPFPPVGAPVKFNKLLYNGRQNYNPQTGIFTCEVPGVYYFAYHVHCKGGNVWVALFKNNEPVMYTYDEYKKGFLDQASGSAVLLLRPGDRVFLQMPSEQAAGLYAGQYVHSSFSGYLLYPM Predict reactive species Full Name: collagen, type VIII, alpha 1 Calculated Molecular Weight: 744 aa, 73 kDa Observed Molecular Weight: 73-75 kDa GenBank Accession Number: BC013581 Gene Symbol: COL8A1 Gene ID (NCBI): 1295 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P27658 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924