Iright
BRAND / VENDOR: Proteintech

Proteintech, 87281-1-RR, PLAGL1 Recombinant monoclonal antibody

CATALOG NUMBER: 87281-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PLAGL1 (87281-1-RR) by Proteintech is a Recombinant antibody targeting PLAGL1 in WB, ELISA applications with reactivity to human samples 87281-1-RR targets PLAGL1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information PLAGL1 (Pleomorphic adenoma gene-like 1) is a crucial zinc-finger transcription factor acting as a tumor suppressor, regulating cell cycle, growth (apoptosis), and embryonic development, particularly involved in pancreatic function and imprinted expression (paternal allele). While its family member PLAG1 is an oncogene in salivary tumors, PLAGL1 often suppresses tumors, though its dysregulation is linked to transient neonatal diabetes mellitus (TNDM) and certain cancers, highlighting its complex role in growth control and metabolic homeostasis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag23073 Product name: Recombinant human PLAGL1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 201-463 aa of BC074814 Sequence: RHTKKTHSQELMKESLQTGDLLSTFHTISPSFQLKAAALPPFPLGASAQNGLASSLPAEVHSLTLSPPEQAAQPMQPLPESLASLHPSVSPGSPPPPLPNHKYNTTSTSYSPLASLPLKADTKGFCNISLFEDLPLQEPQSPQKLNPGFDLAKGNAGKVNLPKELPADAVNLTIPASLDLSPLLGFWQLPPPATQNTFGNSTLALGPGESLPHRLSCLGQQQQEPPLAMGTVSLGQLPLPPIPHVFSAGTGSAILPHFHHAFR Predict reactive species Full Name: pleiomorphic adenoma gene-like 1 Calculated Molecular Weight: 463 aa, 51 kDa Observed Molecular Weight: 51 kDa GenBank Accession Number: BC074814 Gene Symbol: PLAGL1 Gene ID (NCBI): 5325 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UM63 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924