Proteintech, 87307-1-RR, HEY1 Recombinant monoclonal antibody

Size: 20ul / 100ul The HEY1 (87307-1-RR) by Proteintech is a Recombinant antibody targeting HEY1 in WB, ELISA applications with reactivity to human samples 87307-1-RR targets HEY1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HCT 116 cells, 143B cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Hairy/enhancer of split-related proteins are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation. And HEY1 is one of such protein. It is the direct downstream effector of Notch signaling which may be required for cardiovascular development. It preferentially bind to the canonical E box sequence 5'-CACGTG-3' and acts as a transcriptional repressor. HEY1 is a 33kDa protein and forms dimer by self-associating. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14094 Product name: Recombinant human HEY1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 155-295 aa of BC001873 Sequence: VSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGSLGPVLPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQAANLGKPYR Predict reactive species Full Name: hairy/enhancer-of-split related with YRPW motif 1 Calculated Molecular Weight: 304 aa, 33 kDa Observed Molecular Weight: 32-34 kDa GenBank Accession Number: BC001873 Gene Symbol: HEY1 Gene ID (NCBI): 23462 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y5J3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.